Recombinant Human Novel Coronavirus Spike glycoprotein(S) | CSB-YP3324GMYa4

(No reviews yet) Write a Review
SKU:
CSB-YP3324GMYa4
Availability:
Usually Shipped in 5 Working Days
€386.00 - €1,405.00
Frequently bought together:

Description

Recombinant Human Novel Coronavirus Spike glycoprotein(S) | CSB-YP3324GMYa4 | Cusabio

Description: Recombinant Human Novel Coronavirus Spike glycoprotein(S) expressed in Yeast. The protein is and has purity lyophilized powder and has purity greater than 90% as determined by SDS-PAGE. The expression region is 16-685aa (Partial) and the protein is N-terminal 6xHis-sumostar-tagged

Recombinant Human Novel Coronavirus Spike glycoprotein(S) is Available at Gentaur Genprice with the fastest delivery.

Online Order Payment is possible or send quotation to [email protected]

Specifications: Uniprot: P0DTC2; Molecular weight: 88.1 kDa; Expression region: 16-685aa; Tag: N-terminal 6xHis-sumostar-tagged; Host: Yeast; Origin species: SARS-CoV-2; Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Additional Information: Target protein sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Storage and shipping: Shipped on ice packs. For short term storage keep at +4C. For long term storage keep frozen and -20C.

Notes: For research use only.

View AllClose