Recombinant Human coronavirus OC43 Spike glycoprotein(S) ,partial | CSB-EP336163HIY

Recombinant Human coronavirus OC43 Spike glycoprotein(S) ,partial | CSB-EP336163HIY | Cusabio

Description: Recombinant Human coronavirus OC43 Spike glycoprotein(S) ,partial expressed in E.coli. The protein is and has purity Liquid or lyophilized powder and has purity greater than 90% as determined by SDS-PAGE. The expression region is 15-344aa (Partial) and the protein is N-terminal 6xHis-SUMO-tagged

Recombinant Human coronavirus OC43 Spike glycoprotein(S) ,partial is Available at Gentaur Genprice with the fastest delivery.

Online Order Payment is possible or send quotation to info@gentaur.com.

Specifications: Uniprot: P36334; Molecular weight: 53.6 kDa; Expression region: 15-344aa; Tag: N-terminal 6xHis-SUMO-tagged; Host: E.coli; Origin species: HCoV-OC43; Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Additional Information: Target protein sequence: VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Storage and shipping: Shipped on ice packs. For short term storage keep at +4C. For long term storage keep frozen and -20C.

Notes: For research use only.