Cusabio
Recombinant Bovine coronavirus Nucleoprotein(N) | CSB-EP320768BJK
- SKU:
- CSB-EP320768BJK
- Availability:
- Usually Shipped in 5 Working Days
Description
Recombinant Bovine coronavirus Nucleoprotein(N) | CSB-EP320768BJK | Cusabio
Description: Recombinant Bovine coronavirus Nucleoprotein(N) expressed in E.coli. The protein is and has purity Liquid or lyophilized powder and has purity greater than 85% as determined by SDS-PAGE. The expression region is 1-448aa (Full Length) and the protein is N-terminal 6xHis-tagged
Recombinant Bovine coronavirus Nucleoprotein(N) is Available at Gentaur Genprice with the fastest delivery.
Online Order Payment is possible or send quotation to info@gentaur.com.
Specifications: Uniprot: P10527; Molecular weight: 55.3 kDa; Expression region: 1-448aa; Tag: N-terminal 6xHis-tagged; Host: E.coli; Origin species: BCoV; Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Additional Information: Target protein sequence: MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Storage and shipping: Shipped on ice packs. For short term storage keep at +4C. For long term storage keep frozen and -20C.
Notes: For research use only.