Cusabio
Recombinant Bovine coronavirus Spike glycoprotein(S),partial | CSB-EP322803BJK
- SKU:
- CSB-EP322803BJK
- Availability:
- Usually Shipped in 5 Working Days
Description
Recombinant Bovine coronavirus Spike glycoprotein(S),partial | CSB-EP322803BJK | Cusabio
Description: Recombinant Bovine coronavirus Spike glycoprotein(S),partial expressed in E.coli. The protein is and has purity Liquid or lyophilized powder and has purity greater than 85% as determined by SDS-PAGE. The expression region is 326-540aa (Partial) and the protein is N-terminal 10xHis-tagged
Recombinant Bovine coronavirus Spike glycoprotein(S),partial is Available at Gentaur Genprice with the fastest delivery.
Online Order Payment is possible or send quotation to info@gentaur.com.
Specifications: Uniprot: P15777; Molecular weight: 27.2 kDa; Expression region: 326-540aa; Tag: N-terminal 10xHis-tagged; Host: E.coli; Origin species: BCoV; Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Additional Information: Target protein sequence: PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT
Storage and shipping: Shipped on ice packs. For short term storage keep at +4C. For long term storage keep frozen and -20C.
Notes: For research use only.